Disulfide Bond and Glycosylation Site Occupancy Mapping of Trastuzumab Using a Novel Capillary MAbPac RP Column Zoltan Szabo1, Xuefei Sun1, Brandon Robson1, Mike Baynham2 and Shanhua Lin1 1Thermo Fisher Scientific, Sunnyvale, USA, 2Thermo Fisher Scientific, Runcorn, UK ABSTRACT RESULTS Purpose:…
Key words
disulfide, peptide, trastuzumab, glycosylation, vtitcr, bond, aedtavyycsr, originally, heavy, sgtdftltisslqpedfatyycqqhyttpptfgqgtk, aspartic, asparagine, sgtasvvcllnnfypr, thtcppcpapellggpsvflfppkpk, nqvsltclvk