Development of a multiplex ultra-sensitive LC-MS method for the quantification of Alzheimer's disease main blood biomarkers (pTau,Tau, APOE, Aβ, 𝜶-synuclein) : a challenge

Posters | 2023 | Shimadzu | ASMSInstrumentation

Sample Preparation, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC columns, LC/QQQ

Industries

Clinical Research

Manufacturer

Agilent Technologies, Shimadzu, Bruker, Evosep

Go to the library View PDF

Downloadable PDF for viewing

Similar PDF

A multiplex targeted Mass spectrometry approach for the quantification of synuclein proteoforms in human biological fluids

2020|Shimadzu|Posters

TP 535 A multiplex targeted Mass spectrometry approach for the quantification of synuclein proteoforms in human biological fluids 1, 2 1 2 1 1 Pons ML , Vialaret J , Moreau S , Lehmann S and Hirtz C 1 IRMB,…

Key words

synuclein, proteotypic, peptide, alpha, immunocapture, csf, hemoglobin, multiplex, targeted, agsiaaatgfvkkdqlgkneegapqegiledmpvdpdneayemp, anytical, egvlyvgsk, egvvaaaek, egvvgavek, egvvhgvatvaek

Development of an IP-MALDI Method for Analyzing Endogenous Tau Fragments in Cerebrospinal Fluid

2024|Shimadzu|Posters

WP 082 Development of an IP-MALDI Method for Analyzing Endogenous Tau Fragments in Cerebrospinal Fluid Kazushi Ohta, Yusaku Hioki, Rie Yamamoto, Masaki Murase, Koichi Tanaka Koichi Tanaka Mass Spectrometry Research Laboratory, Shimadzu Corporation 1. Introduction 3. Results 3-1. Mid-domain tau…