Application Note Biopharma/Pharma Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities Using an Agilent 1290 Infinity III bio 2D-LC and an Agilent 6545XT AdvanceBio LC/Q-TOF Authors Abstract Paramjeet Khandpur, Preeti Bharatiya, and Ashish Pargaonkar Agilent Technologies, Inc.…
Klíčová slova
semaglutide, haegtftsdvssylegqaakefiawlvrgrg, impurities, peptide, aegtftsdvssylegqaakefiawlvrgrg, sequence, impurity, advancebio, mass, acquisition, modifications, truncated, peptides, mhc, separation