Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Klíčová slova
return, section, contents, peptide, counts, oxidation, liraglutide, tirzepatide, semaglutide, min, mass, time, advancebio, haegtftsdvssylegqaakefiawlvrgrg, abundance