Quality Control of Synthetic Biomolecules Using Rapid Methods with Serial Coupling of UV and MS Detectors Sylvia Grosse, Katherine Lovejoy, Martin Samonig, Mauro De Pra, Frank Steiner, Martin Ruehl, Thermo Fisher Scientific, Dornierstrasse 4, 82110 Germering, Germany ABSTRACT INSTRUMENTATION AND…
Klíčová slova
mass, biomolecules, peptide, dna, preheater, sequence, observed, average, isq, atgatattatgattaggagccgcgcagggag, caggaaacagctatgacccgcgctcacctcgcctctg, [LL-37, 37 aa], rkskekigkefkrivqrikdflrnlvprtes, skekigkefkrivqrikdflr, tgaaggaitgcactgaaaggcaggctaat