High Resolution Glycopeptide Mapping of EPO Using an Agilent AdvanceBio Peptide Mapping Column Application Note BioPharma Authors Abstract James Martosella, Phu Duong, and The 2.7 µm Agilent AdvanceBio Peptide Mapping column is specifically designed to Alex Zhu improve separations of…
Klíčová slova
rhepo, vysnflr, mapping, eaenittgcaehcslnenitvpdtkvnfyawk, vnfyawkr, peptide, lfrvysnflr, vysnflrgk, vlerylleakeaenittgcaehcslnenitvpdtk, vnfyawk, advancebio, eaenittgcaehcslnenitvpdtkvnfyawkr, vysnflrgklk, ylleakeaenittgcaehcslnenitvpdtkvnfyawk, glycopeptide